PDB entry 1bsy

View 1bsy on RCSB PDB site
Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 7.1
Class: transport
Keywords: transport, beta-lactoglobulin, ph-dependent conformation, loop movement, tanford transition, crystal structure
Deposited on 1998-08-31, released 1999-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (0-161)
      • see remark 999 (63)
      • see remark 999 (117)
    Domains in SCOPe 2.08: d1bsya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsyA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi