PDB entry 1bsx

View 1bsx on RCSB PDB site
Description: structure and specificity of nuclear receptor-coactivator interactions
Deposited on 1998-08-31, released 1999-08-26
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-26, with a file datestamp of 1999-08-25.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.249
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bsxa_
  • Chain 'B':
    Domains in SCOP 1.55: d1bsxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bsxA (A:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
    hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
    ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
    riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
    fpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsxA (A:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
    aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
    gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
    fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
    fed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bsxB (B:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
    hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
    ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
    riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
    fpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsxB (B:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
    aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
    gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
    fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
    fed