PDB entry 1bsx

View 1bsx on RCSB PDB site
Description: structure and specificity of nuclear receptor-coactivator interactions
Class: hormone/growth factor
Keywords: nuclear receptors, coactivators, grip1, specificity interaction site, hormone/growth factor complex
Deposited on 1998-08-31, released 1999-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.249
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thyroid hormone receptor beta)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsxa_
  • Chain 'B':
    Compound: protein (thyroid hormone receptor beta)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsxb_
  • Chain 'X':
    Compound: protein (grip1)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BSX (Start-12)
  • Chain 'Y':
    Compound: protein (grip1)
    Database cross-references and differences (RAF-indexed):
    • PDB 1BSX (Start-12)
  • Heterogens: T3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bsxA (A:)
    eelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeg
    gkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavry
    dpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmss
    drpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflh
    mkvecptelfpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsxA (A:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
    aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
    gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
    fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
    fed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bsxB (B:)
    eelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeg
    gkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavry
    dpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmss
    drpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflh
    mkvecptelfpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsxB (B:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapkvdleafshftkiitp
    aitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltlngemavtr
    gqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacveriekyqds
    fllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptelfpplflev
    fed
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.