PDB entry 1bsw

View 1bsw on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5
Deposited on 1998-08-31, released 1999-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 1999-08-26, with a file datestamp of 1999-08-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1bswa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bswA (A:)
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiakenppciln