PDB entry 1bsu

View 1bsu on RCSB PDB site
Description: structural and energetic origins of indirect readout in site-specific DNA cleavage by a restriction endonuclease
Class: hydrolase/DNA
Keywords: complex endonuclease ecorv (3.1.21.4)/DNA, hydrolase/DNA complex
Deposited on 1998-08-30, released 1998-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease ecorv (3.1.21.4)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsua_
  • Chain 'B':
    Compound: endonuclease ecorv (3.1.21.4)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsub_
  • Chain 'C':
    Compound: DNA (5'-d(p*ap*ap*gp*ap*(5cm)p*ip*tp*cp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*(5cm)p*ip*tp*cp*tp*t)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bsuA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsuA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttn
    igsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bsuB (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsuB (B:)
    slrsdlinalydedvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyivee
    pkqqnhypdftlykpsepnkkiaidikttytnikftlggytsfirnntknivypfdqyia
    hwiigyvytrvslktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsihah
    ykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.