PDB entry 1bss

View 1bss on RCSB PDB site
Description: ecorv-t93a/DNA/ca2+
Class: hydrolase/DNA
Keywords: complex (endonuclease ecorv-DNA), hydrolase-DNA complex
Deposited on 1998-08-30, released 1998-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04390 (Start-243)
      • engineered (91)
    Domains in SCOPe 2.07: d1bssa_
  • Chain 'B':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04390 (0-243)
      • engineered (91)
    Domains in SCOPe 2.07: d1bssb_
  • Chain 'C':
    Compound: 5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bssA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikatytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bssA (A:)
    lrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyi
    veepqqnhypdftlykpsepnkkiaidikatytkikftlggytsfirnntknivypfdqy
    iahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsihah
    ykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bssB (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikatytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bssB (B:)
    slrsdlinalydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyiveepk
    qqnhypdftlykpsepnkkiaidikatytnkikftlggytsfirnntknivypfdqyiah
    wiigyvytrslktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsihahyk
    dfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.