PDB entry 1bsr

View 1bsr on RCSB PDB site
Description: bovine seminal ribonuclease structure at 1.9 angstroms resolution
Class: hydrolase(phosphoric diester,RNA)
Keywords: hydrolase(phosphoric diester,RNA)
Deposited on 1993-04-28, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bsra_
  • Chain 'B':
    Compound: bovine seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bsrb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsrA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsrB (B:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv