PDB entry 1bsq

View 1bsq on RCSB PDB site
Description: structural and functional consequences of point mutations of variants a and b of bovine beta-lactoglobulin
Class: hormone/growth factor
Keywords: bovine beta-lactoglobulin, crystal structure, genetic variants, point mutation, hydrophobic, hormone/growth factor complex
Deposited on 1998-08-29, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.239
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-lactoglobulin)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bsqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsqA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi