PDB entry 1bso

View 1bso on RCSB PDB site
Description: 12-bromododecanoic acid binds inside the calyx of bovine beta-lactoglobulin
Class: transport protein
Keywords: beta-lactoglobulin, ligand binding, x-ray crystal structure, transport protein
Deposited on 1998-08-29, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bovine beta-lactoglobulin a)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (0-161)
      • conflict (63)
      • conflict (117)
    Domains in SCOPe 2.08: d1bsoa_
  • Heterogens: BRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsoA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi