PDB entry 1bsn

View 1bsn on RCSB PDB site
Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Class: hydrolase
Keywords: atpsynthase, f1-ATPase, epsilon subunit, nmr spectroscopy, hydrolase
Deposited on 1998-08-28, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-07, with a file datestamp of 2021-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (epsilon subunit)
    Species: Escherichia coli [TaxId:562]
    Gene: UNCC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bsna1, d1bsna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bsnA (A:)
amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
fiylsggilevqpgnvtvladtairgqdldearameakrkaeehissshgdvdyaqasae
lakaiaqlrvieltkkam