PDB entry 1bsm

View 1bsm on RCSB PDB site
Description: p.shermanii sod(fe+3) 140k ph8
Deposited on 1998-08-28, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.205
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsmA (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsmB (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva