PDB entry 1bsm

View 1bsm on RCSB PDB site
Description: p.shermanii sod(fe+3) 140k ph8
Class: oxidoreductase
Keywords: superoxide dismutase, oxidoreductase
Deposited on 1998-08-28, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.205
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsma1, d1bsma2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsmb1, d1bsmb2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsmA (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsmB (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva