PDB entry 1bsj

View 1bsj on RCSB PDB site
Description: cobalt deformylase inhibitor complex from e.coli
Class: hydrolase
Keywords: deformylase, inhibitor, metalloproteinase, hydrolase
Deposited on 1998-08-28, released 2000-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peptide deformylase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsja_
  • Heterogens: CO, PO4, MLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bsjA (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bsjA (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlka