PDB entry 1bsh

View 1bsh on RCSB PDB site
Description: solution structure of the epsilon subunit of the f1-atpsynthase from escherichia coli and orientation of the subunit relative to the beta subunits of the complex
Class: hydrolase
Keywords: atpsynthase, f1-ATPase, epsilon subunit, nmr spectroscopy, hydrolase
Deposited on 1998-08-27, released 1998-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (epsilon subunit)
    Species: Escherichia coli [TaxId:562]
    Gene: UNCC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bsha1, d1bsha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bshA (A:)
    amtyhldvvsaeqqmfsglvekiqvtgsegelgiypghaplltaikpgmirivkqhghee
    fiylsggilevqpgnvtvladtairgqdldearameakrkaeehissshgdvdyaqasae
    lakaiaqlrvieltkkam