PDB entry 1bsg

View 1bsg on RCSB PDB site
Description: beta-lactamase from streptomyces albus g
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, penicillin
Deposited on 1998-07-20, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.152
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta lactamase
    Species: Streptomyces albus [TaxId:1962]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14559 (0-265)
      • conflict (92-93)
    Domains in SCOPe 2.07: d1bsga_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsgA (A:)
    sdaerrlaglerasgarlgvyaydtgsgrtvayradelfpmcsvfktlssaavlrdldrn
    geflsrrilytqddveqadgapetgkpqnlangmtveelcevsitasdncaanlmlrelg
    gpaavtrfvrslgdrvtrldrwepelnsaepgrvtdttspraitrtygrlvlgdalnprd
    rrlltswllanttsgdrfraglpddwtlgdktgagrygtnndagvtwppgrapivltvlt
    akteqdaarddglvadaarvlaetlg