PDB entry 1bsa

View 1bsa on RCSB PDB site
Description: crystal structural analysis of mutations in the hydrophobic cores of barnase
Deposited on 1993-07-19, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bsaa_
  • Chain 'B':
    Domains in SCOP 1.55: d1bsab_
  • Chain 'C':
    Domains in SCOP 1.55: d1bsac_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsaA (A:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksvggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsaB (B:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksvggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bsaC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksvggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir