PDB entry 1bs9

View 1bs9 on RCSB PDB site
Description: acetylxylan esterase from p. purpurogenum refined at 1.10 angstroms
Deposited on 1998-09-01, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1226
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bs9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs9_ (-)
    scpaihvfgarettaspgygssstvvngvlsaypgstaeainypacggqsscggasysss
    vaqgiaavasavnsfnsqcpstkivlvgysqggeimdvalcgggdpnqgytntavqlsss
    avnmvkaaifmgdpmfraglsyevgtcaaggfdqrpagfscpsaakiksycdasdpyccn
    gsnaathqgygseygsqalafvksklg