PDB entry 1bs9

View 1bs9 on RCSB PDB site
Description: acetylxylan esterase from p. purpurogenum refined at 1.10 angstroms
Class: serine hydrolase
Keywords: serine hydrolase, esterase, alpha/beta hydrolase
Deposited on 1998-09-01, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.123
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Penicillium purpurogenum [TaxId:28575]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bs9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs9A (A:)
    scpaihvfgarettaspgygssstvvngvlsaypgstaeainypacggqsscggasysss
    vaqgiaavasavnsfnsqcpstkivlvgysqggeimdvalcgggdpnqgytntavqlsss
    avnmvkaaifmgdpmfraglsyevgtcaaggfdqrpagfscpsaakiksycdasdpyccn
    gsnaathqgygseygsqalafvksklg