PDB entry 1bs7

View 1bs7 on RCSB PDB site
Description: peptide deformylase as ni2+ containing form
Deposited on 1998-09-01, released 1999-08-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-27, with a file datestamp of 1999-08-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bs7a_
  • Chain 'B':
    Domains in SCOP 1.55: d1bs7b_
  • Chain 'C':
    Domains in SCOP 1.55: d1bs7c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs7A (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs7B (B:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs7C (C:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara