PDB entry 1bs6

View 1bs6 on RCSB PDB site
Description: peptide deformylase as ni2+ containing form in complex with tripeptide met-ala-ser
Class: hydrolase
Keywords: hydrolase, iron metalloprotease; protein synthesis
Deposited on 1998-09-01, released 1999-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peptide deformylase)
    Species: Escherichia coli [TaxId:562]
    Gene: def
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bs6a_
  • Chain 'B':
    Compound: protein (peptide deformylase)
    Species: Escherichia coli [TaxId:562]
    Gene: def
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bs6b_
  • Chain 'C':
    Compound: protein (peptide deformylase)
    Species: Escherichia coli [TaxId:562]
    Gene: def
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bs6c_
  • Chain 'D':
    Compound: protein (met-ala-ser)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1BS6 (0-2)
  • Chain 'E':
    Compound: protein (met-ala-ser)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1BS6 (0-2)
  • Chain 'F':
    Compound: protein (met-ala-ser)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1BS6 (0-2)
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs6A (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs6B (B:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs6C (C:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.