PDB entry 1bs4

View 1bs4 on RCSB PDB site
Description: peptide deformylase as zn2+ containing form (native) in complex with inhibitor polyethylene glycol
Deposited on 1998-09-01, released 1999-08-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-27, with a file datestamp of 1999-08-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bs4a_
  • Chain 'B':
    Domains in SCOP 1.55: d1bs4b_
  • Chain 'C':
    Domains in SCOP 1.55: d1bs4c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs4A (A:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs4B (B:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs4C (C:)
    svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
    dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
    eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrlkara