PDB entry 1bs3

View 1bs3 on RCSB PDB site
Description: p.shermanii sod(fe+3) fluoride
Class: oxidoreductase
Keywords: superoxide dismutase, fluoride, oxidoreductase
Deposited on 1998-08-31, released 1999-06-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bs3a1, d1bs3a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bs3b1, d1bs3b2
  • Heterogens: FE, F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs3A (A:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bs3B (B:)
    avytlpelpydysalepyisgeimelhhdkhhkayvdgantaldklaeardkadfgaink
    lekdlafnlaghvnhsvfwknmapkgsaperptdelgaaideffgsfdnmkaqftaaatg
    iqgsgwaslvwdplgkrintlqfydhqnnlpagsipllqldmwehafylqyknvkgdyvk
    swwnvvnwddvalrfsearva