PDB entry 1bs2

View 1bs2 on RCSB PDB site
Description: yeast arginyl-tRNA synthetase
Class: ligase
Keywords: ligase, aminoacyl-tRNA synthetase, protein biosynthesis
Deposited on 1998-08-31, released 1999-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (arginyl-tRNA synthetase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bs2a1, d1bs2a2, d1bs2a3
  • Heterogens: ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bs2A (A:)
    mastanmisqlkklsiaepavakdshpdvnivdlmrnyisqelskisgvdsslifpalew
    tntmergdllipiprlrikganpkdlavqwaekfpcgdflekveangpfiqfffnpqfla
    klvipdiltrkedygscklvenkkviiefsspniakpfhaghlrstiiggflanlyeklg
    wevirmnylgdwgkqfgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipl
    eqstngkareyfkrmedgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvske
    smlkaidlfkekglthedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdrye
    kyhfdkmiyviasqqdlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldn
    ileetkekmhevmkknenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermls
    fegdtgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrn
    aikthepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllg
    ltpverm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bs2A (A:)
    anmisqlkklsiaepavakdshpdvnivdlmrnyisqelskisgvdsslifpalewtntm
    ergdllipiprlrikganpkdlavqwaekfpcgdflekveangpfiqfffnpqflaklvi
    pdiltrkedygscklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgwevi
    rmnylgdwgkqfgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipleqst
    ngkareyfkrmedgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskesmlk
    aidlfkekglthedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryekyhf
    dkmiyviasqqdlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldnilee
    tkekmhevmkknenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsfegd
    tgpylqyahsrlrsvernasgitqekwinadfsllkepaakllirllgqypdvlrnaikt
    hepttvvtylfklthqvsscydvlwvagqteelatarlalygaarqvlyngmrllgltpv
    erm