PDB entry 1brz

View 1brz on RCSB PDB site
Description: solution structure of the sweet protein brazzein, nmr, 43 structures
Class: sweet protein
Keywords: sweet protein, cysteine-stabilized alpha-beta
Deposited on 1998-03-12, released 1998-07-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: brazzein
    Species: Pentadiplandra brazzeana [TaxId:43545]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1brza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brzA (A:)
    edkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey