PDB entry 1brz

View 1brz on RCSB PDB site
Description: solution structure of the sweet protein brazzein, nmr, 43 structures
Class: sweet protein
Keywords: sweet protein, cysteine-stabilized alpha-beta
Deposited on 1998-03-12, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: brazzein
  Species: Pentadiplandra brazzeana [TaxId:43545]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56552 (1-53)
  Domains in SCOPe 2.08: d1brza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1brzA (A:)
  edkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey