PDB entry 1bry

View 1bry on RCSB PDB site
Description: bryodin type I rip
Class: ribosome-inactivating protein
Keywords: ribosome-inactivating protein, immunotoxin, bryodin
Deposited on 1997-02-14, released 1998-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Y':
    Compound: bryodin I
    Species: Bryonia dioica [TaxId:3652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bryy_
  • Chain 'Z':
    Compound: bryodin I
    Species: Bryonia dioica [TaxId:3652]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bryz_

PDB Chain Sequences:

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1bryY (Y:)
    mdvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadet
    isvavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaag
    kireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktf
    lpslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsnial
    llnrnnia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bryY (Y:)
    dvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadeti
    svavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaagk
    ireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktfl
    pslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsniall
    lnrnnia
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1bryZ (Z:)
    mdvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadet
    isvavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaag
    kireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktf
    lpslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsnial
    llnrnnia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bryZ (Z:)
    dvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadeti
    svavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaagk
    ireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktfl
    pslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsniall
    lnrnnia