PDB entry 1brw

View 1brw on RCSB PDB site
Description: the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation
Class: transferase
Keywords: nucleoside phosphorylase, domain movement, transferase
Deposited on 1998-08-25, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pyrimidine nucleoside phosphorylase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brwa1, d1brwa2, d1brwa3
  • Chain 'B':
    Compound: protein (pyrimidine nucleoside phosphorylase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brwb1, d1brwb2, d1brwb3
  • Heterogens: PO4, CA, URA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brwA (A:)
    mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
    amvqsgemldlssirgvkvdkhstggvgdtttlvlgplvasvgvpvakmsgrglghtggt
    idklesvpgfhveiskdefirlvnengiaiigqtgdltpadkklyalrdvtatvnsipli
    assimskkiaagadaivldvktgagafmkkldearrlarvmvdigkrvgrrtmavisdms
    qplgyavgnalevkeaietlkgngphdltelcltlgshmvylaekapsldearrlleeai
    rsgaaiaafktflaaqggdasvvddldklpkaaytstvtaaadgyvaemaaddigtaamw
    lgagrakkedvidlavgivlhkkigdrvqkgealatihsnrpdvldvkekieaairlspq
    pvarppliyetiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brwB (B:)
    mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
    amvqsgemldlssirgvkvdkhstggvgdtttlvlgplvasvgvpvakmsgrglghtggt
    idklesvpgfhveiskdefirlvnengiaiigqtgdltpadkklyalrdvtatvnsipli
    assimskkiaagadaivldvktgagafmkkldearrlarvmvdigkrvgrrtmavisdms
    qplgyavgnalevkeaietlkgngphdltelcltlgshmvylaekapsldearrlleeai
    rsgaaiaafktflaaqggdasvvddldklpkaaytstvtaaadgyvaemaaddigtaamw
    lgagrakkedvidlavgivlhkkigdrvqkgealatihsnrpdvldvkekieaairlspq
    pvarppliyetiv