PDB entry 1brv

View 1brv on RCSB PDB site
Description: solution nmr structure of the immunodominant region of protein g of bovine respiratory syncytial virus, 48 structures
Class: glycoprotein
Keywords: attachment protein g of bovine respiratory syncytial virus, immunoglobulin-binding protein, transmembrane, glycoprotein
Deposited on 1996-03-29, released 1997-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein g
  Species: Bovine respiratory syncytial virus [TaxId:31611]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22261 (Start-31)
  Domains in SCOPe 2.08: d1brva_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1brvA (A:)
  nhqdhnnfqtlpyvpcstcegnlaclslchie
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1brvA (A:)
  vpcstcegnlaclslchie