PDB entry 1bru

View 1bru on RCSB PDB site
Description: structure of porcine pancreatic elastase complexed with the elastase inhibitor gr143783
Class: serine protease
Keywords: serine protease, hydrolase
Deposited on 1998-08-24, released 1999-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: elastase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1brup_
  • Heterogens: 1NB, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bruP (P:)
vvggedarpnswpwqvslqydssgqwrhtcggtlvdqswvltaahcisssrtyrvvlgrh
slstnepgslavkvsklvvhqdwnsnqlsngndiallklaspvsltdkiqlgclpaagti
lpnnyvcyvtgwgrlqtngaspdilqqgqllvvdyatcskpgwwgstvktnmicaggdgi
isscngdsggplncqgangqwqvhgivsfgsslgcnyyhkpsvftrvsnyidwinsvian
n