PDB entry 1brt

View 1brt on RCSB PDB site
Description: bromoperoxidase a2 mutant m99t
Class: haloperoxidase
Keywords: haloperoxidase, oxidoreductase, peroxidase, alpha/beta hydrolase fold, mutant m99t
Deposited on 1998-03-30, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.14
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bromoperoxidase a2
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: BPOA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29715 (0-276)
      • engineered (98)
    Domains in SCOPe 2.08: d1brta_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1brtA (A:)
pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
fgqssqpttgydydtfaadlntvletldlqdavlvgfstgtgevaryvssygtariakva
flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
hkalpsaeyvevegaphgllwthaeevntallaflak