PDB entry 1brr

View 1brr on RCSB PDB site
Description: x-ray structure of the bacteriorhodopsin trimer/lipid complex
Class: proton transport
Keywords: proton pump, membrane protein, retinal protein, lipids, photoreceptor, haloarchaea, proton transport
Deposited on 1998-07-28, released 1998-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.256
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriorhodopsin)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brra_
  • Chain 'B':
    Compound: protein (bacteriorhodopsin)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brrb_
  • Chain 'C':
    Compound: protein (bacteriorhodopsin)
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brrc_
  • Heterogens: BGC, RET, ARC, OCT, GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brrA (A:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    dgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brrA (A:)
    qitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmll
    gygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtg
    lvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlw
    saypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1brrB (B:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    dgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brrB (B:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1brrC (C:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    dgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brrC (C:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge