PDB entry 1brq

View 1brq on RCSB PDB site
Description: crystal structure of the trigonal form of human plasma retinol-binding protein at 2.5 angstroms resolution
Class: retinol transport
Keywords: retinol transport
Deposited on 1992-07-27, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinol binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brqA (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdgrser
    nl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brqA (A:)
    erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
    rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycd