PDB entry 1bro

View 1bro on RCSB PDB site
Description: bromoperoxidase a2
Class: haloperoxidase
Keywords: antibiotic biosynthesis, oxidoreductase, peroxidase, alpha/beta hydrolase fold, haloperoxidase
Deposited on 1996-06-01, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bromoperoxidase a2
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: BPOA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1broa_
  • Chain 'B':
    Compound: bromoperoxidase a2
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: BPOA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1broA (A:)
    pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
    fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
    flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
    eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
    hkalpsaeyvevegaphgllwthaeevntallaflak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1broB (B:)
    pfitvgqenstsidlyyedhgtgqpvvlihgfplsghswerqsaalldagyrvitydrrg
    fgqssqpttgydydtfaadlntvletldlqdavlvgfsmgtgevaryvssygtariakva
    flaslepfllktddnpdgaapqeffdgivaavkadryafytgffndfynldenlgtrise
    eavrnswntaasggffaaaaapttwytdfradipridvpalilhgtgdrtlpientarvf
    hkalpsaeyvevegaphgllwthaeevntallaflak