PDB entry 1brm

View 1brm on RCSB PDB site
Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli
Class: oxidoreductase
Keywords: crystal structure, dehydrogenase, escherichia coli, enzyme, nadp, oxidoreductase
Deposited on 1998-08-24, released 1999-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1brma1, d1brma2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1brmb1, d1brmb2
  • Chain 'C':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1brmc1, d1brmc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brmA (A:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brmA (A:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidwkgqaetnk
    ilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndrei
    tmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplrrmlrqla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1brmB (B:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brmB (B:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidewkgqaetn
    kilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndre
    itmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplrrmlrqla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1brmC (C:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brmC (C:)
    mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkeewkgqae
    tnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpnd
    reitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplrrmlrqla