PDB entry 1brl

View 1brl on RCSB PDB site
Description: three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution
Deposited on 1995-03-20, released 1996-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-01, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1brla_
  • Chain 'B':
    Domains in SCOP 1.55: d1brlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brlA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgydfnkgqwrdfvlkghkdtnrridysyeinp
    vgtpeeciaiiqqdidatgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brlA (A:)
    mkfgnflltyqppelsqtevmkrlvnlgkasegcgfdtvwllehhftefgllgnpyvaaa
    hllgatetlnvgtaaivlptahpvrqaedvnlldqmskgrfrfgicrglydkdfrvfgtd
    mdnsralmdcwydlmkegfnegyiaadnehikfpkiqlnpsaytqggapvyvvaesastt
    ewaaerglpmilswiinthekkaqldlynevatehgydvtkidhclsyitsvdhdsnrak
    dicrnflghwydsyvnatkifddsdqtkgyddtnrridysyeinpvgtpeeciaiiqqdi
    datgidniccgfeangseeeiiasmklfqsdvmpylkekq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brlB (B:)
    mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
    fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
    tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
    ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
    aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
    smedkaqqravidvvnani