PDB entry 1brk

View 1brk on RCSB PDB site
Description: barnase mutant with ile 96 replaced by ala
Class: endonuclease
Keywords: alpha/beta protein, endonuclease
Deposited on 1995-03-09, released 1995-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (95)
    Domains in SCOPe 2.06: d1brka_
  • Chain 'B':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (95)
    Domains in SCOPe 2.06: d1brkb_
  • Chain 'C':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-109)
      • conflict (95)
    Domains in SCOPe 2.06: d1brkc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brkA (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brkA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1brkB (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brkB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1brkC (C:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brkC (C:)
    intfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregkl
    pgksgrtwreadinytsgfrnsdrilyssdwlaykttdhyqtftkir