PDB entry 1brg

View 1brg on RCSB PDB site
Description: crystallographic analysis of phe->leu substitution in the hydrophobic core of barnase
Class: endonuclease
Keywords: endonuclease
Deposited on 1994-03-30, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (0-107)
      • conflict (4)
    Domains in SCOPe 2.07: d1brga_
  • Chain 'B':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (0-107)
      • conflict (4)
    Domains in SCOPe 2.07: d1brgb_
  • Chain 'C':
    Compound: barnase
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (0-107)
      • conflict (4)
    Domains in SCOPe 2.07: d1brgc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brgA (A:)
    vintldgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brgB (B:)
    vintldgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brgC (C:)
    vintldgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir