PDB entry 1brf

View 1brf on RCSB PDB site
Description: Rubredoxin (Wild Type) from Pyrococcus Furiosus
Class: electron transport
Keywords: iron-sulfur protein, high-resolution structure, electron transport
Deposited on 1998-08-24, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (rubredoxin)
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-52)
  Domains in SCOPe 2.08: d1brfa_
• Heterogens: FE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1brfA (A:)
  akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled