PDB entry 1brd

View 1brd on RCSB PDB site
Description: Model for the structure of Bacteriorhodopsin based on high-resolution Electron Cryo-microscopy
Class: photoreceptor
Keywords: photoreceptor
Deposited on 1990-05-23, released 1991-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacteriorhodopsin precursor
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1brda_
  • Heterogens: RET

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1brdA (A:)
    eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaats
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brdA (A:)
    pewiwlalgtalmglgtlyflvkgmgdakkfyaittlvpaiaftmylsmllgeqnpiywa
    ryadwlfttplllldlallvgtilalvgadgimigtglvgaltwwaistaamlyilyvlf
    fgftsevastfkvlrnvtvvlwsaypvvwlignietllfmvldvsakvgfglillrs