PDB entry 1brc

View 1brc on RCSB PDB site
Description: relocating a negative charge in the binding pocket of trypsin
Class: complex(proteinase/inhibitor)
Keywords: complex(proteinase/inhibitor)
Deposited on 1992-12-17, released 1994-05-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • conflict (170)
      • conflict (203)
    Domains in SCOP 1.75: d1brce_
  • Chain 'I':
    Compound: amyloid beta-protein precursor inhibitor domain (appi)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1brci_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1brcE (E:)
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1brcI (I:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg