PDB entry 1brb

View 1brb on RCSB PDB site
Description: crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti
Class: complex(proteinase/inhibitor)
Keywords: complex(proteinase/inhibitor)
Deposited on 1992-12-17, released 1994-07-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • conflict (170)
      • conflict (203)
    Domains in SCOPe 2.05: d1brbe_
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974
      • conflict (4-5)
      • conflict (54)
    Domains in SCOPe 2.05: d1brbi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brbE (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
    vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1brbI (I:)
    rpdfageppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtagga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1brbI (I:)
    ageppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrta