PDB entry 1bra

View 1bra on RCSB PDB site
Description: relocating a negative charge in the binding pocket of trypsin
Class: proteinase/inhibitor
Keywords: PROTEINASE/INHIBITOR, PROTEINASE-INHIBITOR complex
Deposited on 1992-12-17, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • conflict (170)
      • conflict (203)
    Domains in SCOPe 2.07: d1braa_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1braA (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
    vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan