PDB entry 1br9

View 1br9 on RCSB PDB site
Description: human tissue inhibitor of metalloproteinase-2
Class: proteinase inhibitor
Keywords: proteinase inhibitor
Deposited on 1998-08-28, released 1999-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metalloproteinase-2 inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1br9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1br9A (A:)
    cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
    efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
    ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
    aappkqefldiedp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br9A (A:)
    cscspvhpqqafcnadvvirakavsekevdsgndiygnpikriqyeikqikmfkgpekdi
    efiytapssavcgvsldvggkkeyliagkaegdgkmhitlcdfivpwdtlsttqkkslnh
    ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
    aa