PDB entry 1br7

View 1br7 on RCSB PDB site
Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins
Deposited on 1998-08-27, released 1998-09-02
The last revision was dated 1999-09-24, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Heterogens: PRO, LEU, ASN, ALA, GLN, ASP, MET, TRP, SER, THR, GLU, TYR, LYS, VAL, HIS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1br7_ (-)
    mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
    tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
    pnnasplnaqaadmwsnqteykkvlhekyktaqsdkmttskerhsvskrlqqelrtllms
    gdpgitafpdgdnlfkwvatldgpkdtvyeslkykltlefpsdypykppvvkfttpcwhp
    nvdqsgnicldilkenwtasydvrtillslqsllgepnnasplnaqaadmwsnqteykkv
    lhekyktaqsdkmttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgp
    kdtvyeslkykltlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvr
    tillslqsllgepnnas