PDB entry 1br6

View 1br6 on RCSB PDB site
Description: ricin a chain (recombinant) complex with pteroic acid
Class: hydrolase
Keywords: glycosidase, hydrolase
Deposited on 1998-08-27, released 1998-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ricin)
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02879 (0-267)
      • conflict (0)
    Domains in SCOPe 2.08: d1br6a_
  • Heterogens: PT1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1br6A (A:)
mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
fsvydvsilipiialmvyrcapppssqf