PDB entry 1br4

View 1br4 on RCSB PDB site
Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
Class: muscle protein
Keywords: muscle protein
Deposited on 1998-08-27, released 1998-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.62 Å
R-factor: 0.277
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4a1, d1br4a2
  • Chain 'B':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4b_
  • Chain 'C':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4c1, d1br4c2
  • Chain 'D':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4d_
  • Chain 'E':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4e1, d1br4e2
  • Chain 'F':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4f_
  • Chain 'G':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4g1, d1br4g2
  • Chain 'H':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1br4h_
  • Heterogens: MG, ADP, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1br4A (A:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4A (A:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasspsfsygelekqllqanpileafgnaktvkndnssrfgkfir
    infdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnny
    tflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkernt
    dqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealaka
    kferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
    leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
    iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
    fvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahl
    vleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikal
    eldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlg
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1br4B (B:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4B (B:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1br4C (C:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4C (C:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasspsfsygelekqllqanpileafgnaktvkndnssrfgkfir
    infdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnny
    tflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkernt
    dqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealaka
    kferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
    leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
    iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
    fvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahl
    vleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikal
    eldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlg
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1br4D (D:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4D (D:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1br4E (E:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4E (E:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasspsfsygelekqllqanpileafgnaktvkndnssrfgkfir
    infdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnny
    tflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkernt
    dqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealaka
    kferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
    leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
    iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
    fvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahl
    vleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikal
    eldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlg
    s
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1br4F (F:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4F (F:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1br4G (G:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4G (G:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasspsfsygelekqllqanpileafgnaktvkndnssrfgkfir
    infdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlllegfnny
    tflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivfkkernt
    dqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfaiealaka
    kferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtmfi
    leqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdtsfvekl
    iqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsllnqssdk
    fvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahl
    vleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikal
    eldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafakrqqqlg
    s
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1br4H (H:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br4H (H:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg