PDB entry 1br1

View 1br1 on RCSB PDB site
Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
Class: muscle protein
Keywords: muscle protein
Deposited on 1998-08-26, released 1998-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.227
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1a1, d1br1a2
  • Chain 'B':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1b_
  • Chain 'C':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1c1, d1br1c2
  • Chain 'D':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1d_
  • Chain 'E':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1e1, d1br1e2
  • Chain 'F':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1f_
  • Chain 'G':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1g1, d1br1g2
  • Chain 'H':
    Compound: myosin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1br1h_
  • Heterogens: MG, ALF, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1br1A (A:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1A (A:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkqgpsfsygelekqllqanpileafgnaktvkndnssr
    fgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlll
    egfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivf
    kkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfai
    ealakakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlf
    nhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdt
    sfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsll
    nqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekrag
    kldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqaci
    lmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafak
    rqqqlgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1br1B (B:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1B (B:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1br1C (C:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1C (C:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkqgpsfsygelekqllqanpileafgnaktvkndnssr
    fgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlll
    egfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivf
    kkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfai
    ealakakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlf
    nhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdt
    sfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsll
    nqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekrag
    kldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqaci
    lmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafak
    rqqqlgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1br1D (D:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1D (D:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1br1E (E:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1E (E:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkqgpsfsygelekqllqanpileafgnaktvkndnssr
    fgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlll
    egfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivf
    kkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfai
    ealakakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlf
    nhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdt
    sfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsll
    nqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekrag
    kldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqaci
    lmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafak
    rqqqlgs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1br1F (F:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1F (F:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1br1G (G:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlkitdviiafqaqcrgylarkafakrqqqlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1G (G:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkqgpsfsygelekqllqanpileafgnaktvkndnssr
    fgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqmrndlll
    egfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlqlgnivf
    kkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtkeqadfai
    ealakakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlf
    nhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecwfpkatdt
    sfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltknmdplndnvtsll
    nqssdkfvadlwkdvdrivglfrtvgqlykeqltklmttlrntnpnfvrciipnhekrag
    kldahlvleqlrcngvlegiricrqgfpnrivfqefrqryeilaanaipkgfmdgkqaci
    lmikaleldpnlyrigqskiffrtgvlahleeerdlkitdviiafqaqcrgylarkafak
    rqqqlgs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1br1H (H:)
    cdfseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemn
    lktlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmt
    eeeveqlvaghedsngcinyeelvrmvlsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br1H (H:)
    fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
    tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
    eveqlvaghedsngcinyeelvrmvlsg