PDB entry 1br0

View 1br0 on RCSB PDB site
Description: three dimensional structure of the n-terminal domain of syntaxin 1a
Class: membrane protein
Keywords: syntaxin, membrane fusion, synaptic vesicle exocytosis, nmr, membrane protein
Deposited on 1998-08-25, released 1998-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (syntaxin 1-a)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32851 (0-119)
      • engineered (118)
    Domains in SCOPe 2.07: d1br0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1br0A (A:)
    drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta
    nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrersk