PDB entry 1bqz

View 1bqz on RCSB PDB site
Description: j-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Class: chaperone
Keywords: chaperone, heat shock, protein folding, dnak
Deposited on 1998-08-20, released 1999-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnaj
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bqza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bqzA (A:)
akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
kraaydqyghaafeqgg