PDB entry 1bqy

View 1bqy on RCSB PDB site
Description: Plasminogen activator (TSV-PA) from snake venom
Class: hydrolase/hydrolase inhibitor
Keywords: fibrinolysis, plasminogen activator, serine proteinase, snake venom, hydrolase-hydrolase inhibitor complex, blood clotting
Deposited on 1998-08-20, released 1999-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator
    Species: Viridovipera stejnegeri [TaxId:39682]
    Database cross-references and differences (RAF-indexed):
    • PIR A57290 (0-226)
    Domains in SCOPe 2.07: d1bqya_
  • Chain 'B':
    Compound: plasminogen activator
    Species: Viridovipera stejnegeri [TaxId:39682]
    Database cross-references and differences (RAF-indexed):
    • PIR A57290 (0-226)
    Domains in SCOPe 2.07: d1bqyb_
  • Heterogens: 0GJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqyA (A:)
    vfggdecninehrslvvlfnsngflcggtlinqdwvvtaahcdsnnfqllfgvhskkiln
    edeqtrdpkekffcpnrkkddevdkdimlikldssvsnsehiaplslpssppsvgsvcri
    mgwgktiptkeiypdvphcaninildhavcrtayswrqvanttlcagilqggrdtchfds
    ggplicngifqgivswgghpcgqpgepgvytkvfdyldwiksiiagnkdatcpp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqyB (B:)
    vfggdecninehrslvvlfnsngflcggtlinqdwvvtaahcdsnnfqllfgvhskkiln
    edeqtrdpkekffcpnrkkddevdkdimlikldssvsnsehiaplslpssppsvgsvcri
    mgwgktiptkeiypdvphcaninildhavcrtayswrqvanttlcagilqggrdtchfds
    ggplicngifqgivswgghpcgqpgepgvytkvfdyldwiksiiagnkdatcpp